PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN543274.1_FGP002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 514aa    MW: 57367.5 Da    PI: 4.4184
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN543274.1_FGP002genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS431.85.1e-1321455142374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++lL++cA+a+s+ +  +aq++++ l++++s +gdp qR+aay++e+Laar++ s++++ykal+++e +   +  +l+a+++++e++P+++f
  KN543274.1_FGP002 145 KQLLFDCATALSDYNVDEAQSIITDLRQMVSIQGDPSQRIAAYLVEGLAARIVASGKGIYKALSCKEPP---TLYQLSAMQILFEICPCFRF 233
                        589*****************************************************************9...89999*************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        ++++aN aIlea +ge+rvHiiDfdi+qG Q+++L+q L + +++p +lRiTgv++pe++      le +g+rL+k+Ae +gv+fef++ v 
  KN543274.1_FGP002 234 GFMAANYAILEACKGEDRVHIIDFDINQGSQYITLIQFLKNNANKPRHLRITGVDDPETVqrTVGGLEVIGQRLEKLAEDCGVSFEFRA-VG 324
                        **********************************************************99778889***********************.79 PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                         ++ d+++ +L+++pgEal+Vn+++qlh+l+desvs+ +erd++L++vk+l+Pk+v++veq+a++n+++F +rf e  +yy+alfdsl+a+l
  KN543274.1_FGP002 325 ANIGDVTPAMLDCRPGEALVVNFAFQLHHLPDESVSIMNERDQLLRMVKGLQPKLVTLVEQDANTNTAPFQTRFREVYDYYAALFDSLDATL 416
                        9******************************************************************************************* PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                        pres +r++vEr++l+reivn++aceg +r+er e ++kWr+r+++aGF+p p+s+++ + +++ll+ + ++ y+ ee++g l +gW +++L
  KN543274.1_FGP002 417 PRESPDRMNVERQCLAREIVNILACEGPDRVERYEVAGKWRARMTMAGFTPCPFSSNVISGIRSLLKSYCDR-YKFEEDHGGLHFGWGEKTL 507
                        **********************************************************************66.******************* PP

               GRAS 368 vsvSaWr 374
                        ++ SaW+
  KN543274.1_FGP002 508 IVSSAWQ 514
                        ******6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.579118495IPR005202Transcription factor GRAS
PfamPF035141.8E-129145514IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
LFRYGPEPYN PENSFYNQQA SPMPYMVTAD GHSPPSADNS CSDVAKDSPL VSNVSQQNSQ  60
SISDNQSSEL EVEFDEDDIR MKLQELEHAL LDDSDDILYE ISQAGSINDE WADPMKNVIL  120
PNSPKESESS ISCAGSNNGE PRTPKQLLFD CATALSDYNV DEAQSIITDL RQMVSIQGDP  180
SQRIAAYLVE GLAARIVASG KGIYKALSCK EPPTLYQLSA MQILFEICPC FRFGFMAANY  240
AILEACKGED RVHIIDFDIN QGSQYITLIQ FLKNNANKPR HLRITGVDDP ETVQRTVGGL  300
EVIGQRLEKL AEDCGVSFEF RAVGANIGDV TPAMLDCRPG EALVVNFAFQ LHHLPDESVS  360
IMNERDQLLR MVKGLQPKLV TLVEQDANTN TAPFQTRFRE VYDYYAALFD SLDATLPRES  420
PDRMNVERQC LAREIVNILA CEGPDRVERY EVAGKWRARM TMAGFTPCPF SSNVISGIRS  480
LLKSYCDRYK FEEDHGGLHF GWGEKTLIVS SAWQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-551465146375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0608330.0AK060833.1 Oryza sativa Japonica Group cDNA clone:001-034-C07, full insert sequence.
GenBankAK0674570.0AK067457.1 Oryza sativa Japonica Group cDNA clone:J013106L10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610828.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A0D3EX170.0A0A0D3EX17_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9YI890.0A0A0D9YI89_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0CB540.0A0A0E0CB54_9ORYZ; Uncharacterized protein
TrEMBLI1NTZ30.0I1NTZ3_ORYGL; Uncharacterized protein
STRINGORGLA01G0333300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1